SCOPe 2.07: Domain d4y7cb1: 4y7c B:64-236

Lineage for d4y7cb1 (4y7c B:64-236)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d4y7cb1: 4y7c B:64-236 [314282]
   Other proteins in same PDB: d4y7ca2, d4y7ca3, d4y7cb2, d4y7cb3
   automated match to d1ja1a2
   complexed with fad, fmn, nap, po4; mutant

Details for d4y7cb1

PDB Entry: 4y7c, 2.2 Å

PDB Description: rat cypor mutant - g141del/e142n

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y7cb1:

Sequence; same for both SEQRES and ATOM records:

>d4y7cb1 c.23.5.0 (B:64-236) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladls
slpeidkslvvfcmatyngdptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnam
gkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveat

Timeline for d4y7cb1:

• d4y7cb1 first appeared in SCOPe 2.06
  
• d4y7cb1 appears in the current release, SCOPe 2.08