Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
Domain d5f97h1: 5f97 H:3-114 [314276] Other proteins in same PDB: d5f97e2, d5f97f2, d5f97g2, d5f97h2 automated match to d4ldeb_ complexed with a2g, bgc, fuc, gal, nag |
PDB Entry: 5f97 (more details), 2.62 Å
SCOPe Domain Sequences for d5f97h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f97h1 b.1.1.1 (H:3-114) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs
Timeline for d5f97h1: