SCOP 1.73: Domain d1ce8b2: 1ce8 B:153-380

Lineage for d1ce8b2 (1ce8 B:153-380)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)

7. Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)

8. Domain d1ce8b2: 1ce8 B:153-380 [31425]
   Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1

Details for d1ce8b2

PDB Entry: 1ce8, 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

PDB Compounds: (B:) protein (carbamoyl-phosphate synthase)

SCOP Domain Sequences for d1ce8b2:

Sequence; same for both SEQRES and ATOM records:

>d1ce8b2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

Timeline for d1ce8b2:

• d1ce8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1ce8b2 appears in SCOP 1.71
  
• d1ce8b2 appears in SCOP 1.75
  
• d1ce8b2 appears in the current release, SCOPe 2.08