Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins) |
Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species) |
Species Escherichia coli [TaxId:562] [52322] (7 PDB entries) |
Domain d1ce8b2: 1ce8 B:153-380 [31425] Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1 |
PDB Entry: 1ce8 (more details), 2.1 Å
SCOP Domain Sequences for d1ce8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce8b2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli} lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt
Timeline for d1ce8b2:
View in 3D Domains from other chains: (mouse over for more information) d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2 |