Lineage for d1ce8b2 (1ce8 B:153-380)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22286Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 22287Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins)
  6. 22291Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 22292Species Escherichia coli [TaxId:562] [52322] (7 PDB entries)
  8. 22309Domain d1ce8b2: 1ce8 B:153-380 [31425]
    Other proteins in same PDB: d1ce8a1, d1ce8a2, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8c1, d1ce8c2, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8e1, d1ce8e2, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8g1, d1ce8g2, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1

Details for d1ce8b2

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8b2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1ce8b2:

Click to download the PDB-style file with coordinates for d1ce8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ce8b2: