![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries) |
![]() | Domain d5f93h1: 5f93 H:7-114 [314219] Other proteins in same PDB: d5f93c2, d5f93c3, d5f93d2, d5f93d3, d5f93f2, d5f93f3, d5f93h2, d5f93h3 automated match to d4ldeb_ |
PDB Entry: 5f93 (more details), 2.99 Å
SCOPe Domain Sequences for d5f93h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f93h1 b.1.1.1 (H:7-114) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyadsvkg rftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs
Timeline for d5f93h1: