SCOPe 2.08: Domain d5fcul1: 5fcu L:2-107

Lineage for d5fcul1 (5fcu L:2-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)

8. Domain d5fcul1: 5fcu L:2-107 [314181]
   Other proteins in same PDB: d5fcul2
   automated match to d2mcg11
   complexed with cl, nag, so4

Details for d5fcul1

PDB Entry: 5fcu, 1.85 Å

PDB Description: crystal structure of the inner domain of clade a/e hiv-1 gp120 in complex with the adcc-potent rhesus macaque antibody jr4

PDB Compounds: (L:) jr4 fab light chain

SCOPe Domain Sequences for d5fcul1:

Sequence; same for both SEQRES and ATOM records:

>d5fcul1 b.1.1.0 (L:2-107) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
svltqppsvsaapgqkvtiscsgsssnigrsyvswyqqvpgaapklliydtnkrpsgvsd
rfsgsksgssaslaitglqtgdeadyycgawdgslnvhifgsgtkltvlg

Timeline for d5fcul1:

• d5fcul1 first appeared in SCOPe 2.06
  
• d5fcul1 appears in SCOPe 2.07