SCOPe 2.08: Domain d5f7nd1: 5f7n D:7-114

Lineage for d5f7nd1 (5f7n D:7-114)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5f7nd1: 5f7n D:7-114 [314172]
   Other proteins in same PDB: d5f7nc2, d5f7nc3, d5f7nd2, d5f7nd3
   automated match to d4ldeb_

Details for d5f7nd1

PDB Entry: 5f7n, 2.28 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain 17875 in complex with blood group a lewis b pentasaccharide

PDB Compounds: (D:) Nanobody Nb-ER19

SCOPe Domain Sequences for d5f7nd1:

Sequence; same for both SEQRES and ATOM records:

>d5f7nd1 b.1.1.1 (D:7-114) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyadsvkg
rftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs

Timeline for d5f7nd1:

• d5f7nd1 first appeared in SCOPe 2.06
  
• d5f7nd1 appears in SCOPe 2.07