Lineage for d5f7lb1 (5f7l B:6-121)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 2347916Domain d5f7lb1: 5f7l B:6-121 [314165]
    Other proteins in same PDB: d5f7lb2, d5f7ld2
    automated match to d4ldeb_
    complexed with so4

Details for d5f7lb1

PDB Entry: 5f7l (more details), 2.74 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain 17875 in complex with nanobody nb-er14
PDB Compounds: (B:) Nanobody Nb-ER14

SCOPe Domain Sequences for d5f7lb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f7lb1 b.1.1.1 (B:6-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgsiysliamgwyrqapgkehelvatissgsttyyadsvkg
rftisrdnakntlylqmnslkpedtamyycaaysdrltdcsnceadywgqgtqvtv

SCOPe Domain Coordinates for d5f7lb1:

Click to download the PDB-style file with coordinates for d5f7lb1.
(The format of our PDB-style files is described here.)

Timeline for d5f7lb1:

  • d5f7lb1 first appeared in SCOPe 2.06, called d5f7lb_

View in 3D
Domains from same chain:
(mouse over for more information)
d5f7lb2