Lineage for d1c30f2 (1c30 F:153-380)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120799Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 120800Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins)
  6. 120811Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 120812Species Escherichia coli [TaxId:562] [52322] (8 PDB entries)
  8. 120823Domain d1c30f2: 1c30 F:153-380 [31415]
    Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1

Details for d1c30f2

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30f2 c.23.16.1 (F:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgislgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1c30f2:

Click to download the PDB-style file with coordinates for d1c30f2.
(The format of our PDB-style files is described here.)

Timeline for d1c30f2: