Lineage for d5d75a1 (5d75 A:109-224)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548489Protein FKBP25 [54543] (1 species)
  7. 2548490Species Human (Homo sapiens) [TaxId:9606] [54544] (3 PDB entries)
  8. 2548492Domain d5d75a1: 5d75 A:109-224 [314146]
    Other proteins in same PDB: d5d75a2
    automated match to d1pbka_
    complexed with 6jz, fk5

Details for d5d75a1

PDB Entry: 5d75 (more details), 1.83 Å

PDB Description: crystal structure of human fkbd25 in complex with fk506
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP3

SCOPe Domain Sequences for d5d75a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d75a1 d.26.1.1 (A:109-224) FKBP25 {Human (Homo sapiens) [TaxId: 9606]}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

SCOPe Domain Coordinates for d5d75a1:

Click to download the PDB-style file with coordinates for d5d75a1.
(The format of our PDB-style files is described here.)

Timeline for d5d75a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d75a2