SCOPe 2.07: Domain d5d75a1: 5d75 A:109-224

Lineage for d5d75a1 (5d75 A:109-224)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP25 [54543] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54544] (3 PDB entries)

8. Domain d5d75a1: 5d75 A:109-224 [314146]
   Other proteins in same PDB: d5d75a2
   automated match to d1pbka_
   complexed with 6jz, fk5

Details for d5d75a1

PDB Entry: 5d75, 1.83 Å

PDB Description: crystal structure of human fkbd25 in complex with fk506

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP3

SCOPe Domain Sequences for d5d75a1:

Sequence; same for both SEQRES and ATOM records:

>d5d75a1 d.26.1.1 (A:109-224) FKBP25 {Human (Homo sapiens) [TaxId: 9606]}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

Timeline for d5d75a1:

• d5d75a1 first appeared in SCOPe 2.06
  
• d5d75a1 appears in the current release, SCOPe 2.08