SCOPe 2.08: Domain d5f7fb1: 5f7f B:3-113

Lineage for d5f7fb1 (5f7f B:3-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5f7fb1: 5f7f B:3-113 [314135]
   Other proteins in same PDB: d5f7fa2, d5f7fb2
   automated match to d5dzna_

Details for d5f7fb1

PDB Entry: 5f7f, 1.5 Å

PDB Description: human t-cell immunoglobulin and mucin domain protein 4 (htim-4)

PDB Compounds: (B:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d5f7fb1:

Sequence; same for both SEQRES and ATOM records:

>d5f7fb1 b.1.1.0 (B:3-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrksak
yrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

Timeline for d5f7fb1:

• d5f7fb1 first appeared in SCOPe 2.06
  
• d5f7fb1 appears in SCOPe 2.07