SCOP 1.65: Domain d1c30b2: 1c30 B:153-380

Lineage for d1c30b2 (1c30 B:153-380)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (7 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different costituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (6 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)

7. Species Escherichia coli [TaxId:562] [52322] (9 PDB entries)

8. Domain d1c30b2: 1c30 B:153-380 [31413]
   Other proteins in same PDB: d1c30a1, d1c30a2, d1c30a3, d1c30a4, d1c30a5, d1c30a6, d1c30b1, d1c30c1, d1c30c2, d1c30c3, d1c30c4, d1c30c5, d1c30c6, d1c30d1, d1c30e1, d1c30e2, d1c30e3, d1c30e4, d1c30e5, d1c30e6, d1c30f1, d1c30g1, d1c30g2, d1c30g3, d1c30g4, d1c30g5, d1c30g6, d1c30h1

Details for d1c30b2

PDB Entry: 1c30, 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30b2:

Sequence; same for both SEQRES and ATOM records:

>d1c30b2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgislgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

Timeline for d1c30b2:

• d1c30b2 first appeared (with stable ids) in SCOP 1.55
  
• d1c30b2 appears in SCOP 1.63
  
• d1c30b2 appears in SCOP 1.67
  
• d1c30b2 appears in the current release, SCOPe 2.08