Lineage for d5f1vc_ (5f1v C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834536Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2834546Species Campylobacter jejuni [TaxId:192222] [189204] (3 PDB entries)
  8. 2834553Domain d5f1vc_: 5f1v C: [314125]
    automated match to d3lera_
    complexed with 3vn, edo, gol, pge

    has additional insertions and/or extensions that are not grouped together

Details for d5f1vc_

PDB Entry: 5f1v (more details), 2.2 Å

PDB Description: biomimetic design results in a potent allosteric inhibitor of dihydrodipicolinate synthase from campylobacter jejuni
PDB Compounds: (C:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5f1vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1vc_ c.1.10.1 (C:) Dihydrodipicolinate synthase {Campylobacter jejuni [TaxId: 192222]}
kniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtc
ieiavetckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyeh
ykaiaqsvdipvllynvpgrtgceistdtiiklfrdceniygvxeasgnidkcvdllahe
prmmlisgedainypilsnggkgvisvtsnllpdmisalthfaldenykeakkindelyn
inkilfcesnpipiktamylaglieslefrlplcspskenfakieevmkkykikgf

SCOPe Domain Coordinates for d5f1vc_:

Click to download the PDB-style file with coordinates for d5f1vc_.
(The format of our PDB-style files is described here.)

Timeline for d5f1vc_: