Lineage for d1a9xh2 (1a9x H:7653-7880)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467010Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2467021Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 2467022Species Escherichia coli [TaxId:562] [52322] (10 PDB entries)
    Uniprot P00907
  8. 2467026Domain d1a9xh2: 1a9x H:7653-7880 [31412]
    Other proteins in same PDB: d1a9xa1, d1a9xa2, d1a9xa3, d1a9xa4, d1a9xa5, d1a9xa6, d1a9xb1, d1a9xc1, d1a9xc2, d1a9xc3, d1a9xc4, d1a9xc5, d1a9xc6, d1a9xd1, d1a9xe1, d1a9xe2, d1a9xe3, d1a9xe4, d1a9xe5, d1a9xe6, d1a9xf1, d1a9xg1, d1a9xg2, d1a9xg3, d1a9xg4, d1a9xg5, d1a9xg6, d1a9xh1
    complexed with adp, cl, k, mn, net, orn, po4

Details for d1a9xh2

PDB Entry: 1a9x (more details), 1.8 Å

PDB Description: carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis
PDB Compounds: (H:) carbamoyl phosphate synthetase (small chain)

SCOPe Domain Sequences for d1a9xh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9xh2 c.23.16.1 (H:7653-7880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]}
lngmdlakevttaeayswtqgswtltgglpqakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqgnpeaspgphdaaplfdhfielieqyrkt

SCOPe Domain Coordinates for d1a9xh2:

Click to download the PDB-style file with coordinates for d1a9xh2.
(The format of our PDB-style files is described here.)

Timeline for d1a9xh2: