![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein automated matches [190074] (15 species) not a true protein |
![]() | Species Trypanosoma cruzi [TaxId:353153] [314071] (1 PDB entry) |
![]() | Domain d5eucd_: 5euc D: [314113] automated match to d1p17b_ |
PDB Entry: 5euc (more details), 2.65 Å
SCOPe Domain Sequences for d5eucd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eucd_ c.61.1.1 (D:) automated matches {Trypanosoma cruzi [TaxId: 353153]} eyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcr alcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlnyl yhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdiv vlrpevyae
Timeline for d5eucd_: