Lineage for d5eucd_ (5euc D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891731Protein automated matches [190074] (15 species)
    not a true protein
  7. 2891798Species Trypanosoma cruzi [TaxId:353153] [314071] (1 PDB entry)
  8. 2891802Domain d5eucd_: 5euc D: [314113]
    automated match to d1p17b_

Details for d5eucd_

PDB Entry: 5euc (more details), 2.65 Å

PDB Description: the role of the c-terminal region on the oligomeric state and enzymatic activity of trypanosoma cruzi hypoxanthine phosphoribosyl transferase
PDB Compounds: (D:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5eucd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eucd_ c.61.1.1 (D:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
eyefaekilfteeeirtrikevakriaddykgkglrpyvnplvlisvlkgsfmftadlcr
alcdfnvpvrmeficvssygegltssgqvrmlldtrhsieghhvlivedivdtaltlnyl
yhmyftrrpaslktvvlldkregrrvpfsadyvvanipnafvigygldyddtyrelrdiv
vlrpevyae

SCOPe Domain Coordinates for d5eucd_:

Click to download the PDB-style file with coordinates for d5eucd_.
(The format of our PDB-style files is described here.)

Timeline for d5eucd_: