SCOPe 2.07: Domain d5eu1a_: 5eu1 A:

Lineage for d5eu1a_ (5eu1 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5eu1a_: 5eu1 A: [314099]
   automated match to d3hmeb_
   complexed with 5sw

Details for d5eu1a_

PDB Entry: 5eu1, 1.6 Å

PDB Description: crystal structure of brd9 in complex with bi-7273

PDB Compounds: (A:) brd9

SCOPe Domain Sequences for d5eu1a_:

Sequence; same for both SEQRES and ATOM records:

>d5eu1a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmmskerllalkrsms

Timeline for d5eu1a_:

• d5eu1a_ first appeared in SCOPe 2.06
  
• d5eu1a_ appears in the current release, SCOPe 2.08