SCOPe 2.08: Domain d5f9wc1: 5f9w C:1-106

Lineage for d5f9wc1 (5f9w C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5f9wc1: 5f9w C:1-106 [314093]
   Other proteins in same PDB: d5f9wc2, d5f9wl2
   automated match to d1dn0a1
   complexed with nag, po4

Details for d5f9wc1

PDB Entry: 5f9w, 2.89 Å

PDB Description: crystal structure of broadly neutralizing vh1-46 germline-derived cd4- binding site-directed antibody ch235 in complex with hiv-1 clade a/e 93th057 gp120

PDB Compounds: (C:) Light chain of CH235-lineage antibody CH235

SCOPe Domain Sequences for d5f9wc1:

Sequence; same for both SEQRES and ATOM records:

>d5f9wc1 b.1.1.0 (C:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlsvspgeratlscrasqsvrsnlawyqqrpgqaprlliygtstratgvpa
rfsgrgsgteftlaissmqsedfavylclqynnwwtfgqgtkvei

Timeline for d5f9wc1:

• d5f9wc1 first appeared in SCOPe 2.06
  
• d5f9wc1 appears in SCOPe 2.07