SCOPe 2.08: Domain d5fbmb_: 5fbm B:

Lineage for d5fbmb_ (5fbm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.0: automated matches [191573] (1 protein)
   not a true family

6. Protein automated matches [191007] (11 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [314035] (1 PDB entry)

8. Domain d5fbmb_: 5fbm B: [314079]
   Other proteins in same PDB: d5fbma2
   automated match to d4qjna_

Details for d5fbmb_

PDB Entry: 5fbm, 1.9 Å

PDB Description: crystal structure of histone like protein (hlp) from streptococcus mutans refined to 1.9 a resolution

PDB Compounds: (B:) DNA-binding protein HU

SCOPe Domain Sequences for d5fbmb_:

Sequence, based on SEQRES records:

>d5fbmb_ a.55.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
ankqdliakvaeateltkkdsaaavdavfsavssylakgekvqligfgnfevreraarkg
rnpqtgeeikikaskvpafkagkalkdavk

Sequence, based on observed residues (ATOM records):

>d5fbmb_ a.55.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
ankqdliakvaeateltkkdsaaavdavfsavssylakgekvqligfgnfevreraarke
eikikaskvpafkagkalkdavk

Timeline for d5fbmb_:

• d5fbmb_ first appeared in SCOPe 2.06
  
• d5fbmb_ appears in SCOPe 2.07