SCOPe 2.07: Domain d5f7if1: 5f7i F:1-126

Lineage for d5f7if1 (5f7i F:1-126)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Leishmania donovani [TaxId:5661] [313997] (1 PDB entry)

8. Domain d5f7if1: 5f7i F:1-126 [314074]
   Other proteins in same PDB: d5f7ia3, d5f7ib3, d5f7ic3, d5f7id3, d5f7ie3, d5f7if3
   automated match to d4cs5a1
   protein/DNA complex; complexed with tlv

Details for d5f7if1

PDB Entry: 5f7i, 2.95 Å

PDB Description: crystal structure of the complex of proliferating cell nuclear antigen from leishmania donovani with tetrachloro-l-thyronine at 2.95 angstrom resolution

PDB Compounds: (F:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d5f7if1:

Sequence; same for both SEQRES and ATOM records:

>d5f7if1 d.131.1.0 (F:1-126) automated matches {Leishmania donovani [TaxId: 5661]}
mleaqvqfaslwkrlvecinglvneanfdcnpgglsvqamdsshvalvhmllrddcfvky
qcgrnsilglnlaslskvlkivdsndslslrhdddsdvvtltsenpektrkceyqlklle
ieaesm

Timeline for d5f7if1:

• d5f7if1 first appeared in SCOPe 2.06
  
• d5f7if1 appears in the current release, SCOPe 2.08