Lineage for d1gpmc2 (1gpm C:3-207)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22286Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 22287Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins)
  6. 22321Protein GMP synthetase [52319] (1 species)
  7. 22322Species Escherichia coli [TaxId:562] [52320] (1 PDB entry)
  8. 22325Domain d1gpmc2: 1gpm C:3-207 [31407]
    Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3

Details for d1gpmc2

PDB Entry: 1gpm (more details), 2.2 Å

PDB Description: escherichia coli gmp synthetase complexed with amp and pyrophosphate

SCOP Domain Sequences for d1gpmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpmc2 c.23.16.1 (C:3-207) GMP synthetase {Escherichia coli}
enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes
tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv
rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp
evthtrqgmrmlerfvrdicqceal

SCOP Domain Coordinates for d1gpmc2:

Click to download the PDB-style file with coordinates for d1gpmc2.
(The format of our PDB-style files is described here.)

Timeline for d1gpmc2: