Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (3 proteins) |
Protein GMP synthetase [52319] (1 species) |
Species Escherichia coli [TaxId:562] [52320] (1 PDB entry) |
Domain d1gpmc2: 1gpm C:3-207 [31407] Other proteins in same PDB: d1gpma1, d1gpma3, d1gpmb1, d1gpmb3, d1gpmc1, d1gpmc3, d1gpmd1, d1gpmd3 |
PDB Entry: 1gpm (more details), 2.2 Å
SCOP Domain Sequences for d1gpmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpmc2 c.23.16.1 (C:3-207) GMP synthetase {Escherichia coli} enihkhrilildfgsqytqlvarrvrelgvycelwawdvteaqirdfnpsgiilsggpes tteensprapqyvfeagvpvfgvcygmqtmamqlgghveasnerefgyaqvevvndsalv rgiedaltadgkplldvwmshgdkvtaipsdfitvastescpfaimaneekrfygvqfhp evthtrqgmrmlerfvrdicqceal
Timeline for d1gpmc2: