Lineage for d5f7md1 (5f7m D:3-114)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024695Domain d5f7md1: 5f7m D:3-114 [314069]
    Other proteins in same PDB: d5f7mc2, d5f7md2
    automated match to d4ldeb_
    complexed with bgc, fuc, gal, nag

Details for d5f7md1

PDB Entry: 5f7m (more details), 2.72 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain 17875 in complex with blood group h lewis b hexasaccharide
PDB Compounds: (D:) Nanobody Nb-ER19

SCOPe Domain Sequences for d5f7md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f7md1 b.1.1.1 (D:3-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyad
svkgrftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs

SCOPe Domain Coordinates for d5f7md1:

Click to download the PDB-style file with coordinates for d5f7md1.
(The format of our PDB-style files is described here.)

Timeline for d5f7md1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f7md2