Lineage for d5epoc_ (5epo C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846587Species Clostridium sardiniense [TaxId:29369] [314050] (1 PDB entry)
  8. 2846590Domain d5epoc_: 5epo C: [314061]
    automated match to d1g6ka_
    complexed with gol, nap, tud

Details for d5epoc_

PDB Entry: 5epo (more details), 2 Å

PDB Description: the three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase
PDB Compounds: (C:) 7-alpha-hydroxysteroid deydrogenase

SCOPe Domain Sequences for d5epoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5epoc_ c.2.1.0 (C:) automated matches {Clostridium sardiniense [TaxId: 29369]}
krlegkvaivtsstrgigrasaealakegalvylaarseelaneviadikkqggvakfvy
fnareeetytsmvekvaeaegridilvnnyggtnvnldknltagdtdeffrilkdnvqsv
ylpakaaiphmekvgggsivnistigsvvpdisriaycvsksainsltqnialqyarkni
rcnavlpgligtraalenmtdefrdsflghvplnrvgrpedianavlyyasddsgyvtgm
ihevaggfalgtpqyseycpr

SCOPe Domain Coordinates for d5epoc_:

Click to download the PDB-style file with coordinates for d5epoc_.
(The format of our PDB-style files is described here.)

Timeline for d5epoc_: