Lineage for d1hnxb_ (1hnx B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826781Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 826782Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 826783Protein Ribosomal protein S2 [52315] (3 species)
  7. 826820Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 826843Domain d1hnxb_: 1hnx B: [31404]
    Other proteins in same PDB: d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_
    complexed with mg, pcy, zn

Details for d1hnxb_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
PDB Compounds: (B:) 30S ribosomal protein S2

SCOP Domain Sequences for d1hnxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1hnxb_:

Click to download the PDB-style file with coordinates for d1hnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxb_: