Lineage for d5fbma1 (5fbm A:2-91)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715207Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2715208Protein automated matches [191007] (11 species)
    not a true protein
  7. 2715245Species Streptococcus mutans [TaxId:210007] [314035] (1 PDB entry)
  8. 2715246Domain d5fbma1: 5fbm A:2-91 [314036]
    Other proteins in same PDB: d5fbma2
    automated match to d4qjna_

Details for d5fbma1

PDB Entry: 5fbm (more details), 1.9 Å

PDB Description: crystal structure of histone like protein (hlp) from streptococcus mutans refined to 1.9 a resolution
PDB Compounds: (A:) DNA-binding protein HU

SCOPe Domain Sequences for d5fbma1:

Sequence, based on SEQRES records: (download)

>d5fbma1 a.55.1.0 (A:2-91) automated matches {Streptococcus mutans [TaxId: 210007]}
ankqdliakvaeateltkkdsaaavdavfsavssylakgekvqligfgnfevreraarkg
rnpqtgeeikikaskvpafkagkalkdavk

Sequence, based on observed residues (ATOM records): (download)

>d5fbma1 a.55.1.0 (A:2-91) automated matches {Streptococcus mutans [TaxId: 210007]}
ankqdliakvaeateltkkdsaaavdavfsavssylakgekvqligfgnfevreraarke
ikikaskvpafkagkalkdavk

SCOPe Domain Coordinates for d5fbma1:

Click to download the PDB-style file with coordinates for d5fbma1.
(The format of our PDB-style files is described here.)

Timeline for d5fbma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5fbma2
View in 3D
Domains from other chains:
(mouse over for more information)
d5fbmb_