SCOPe 2.08: Domain d5faia_: 5fai A:

Lineage for d5faia_ (5fai A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [314023] (1 PDB entry)

8. Domain d5faia_: 5fai A: [314024]
   automated match to d2v3ja1
   complexed with cit, sah, unx

Details for d5faia_

PDB Entry: 5fai, 1.8 Å

PDB Description: emg1 n1-specific pseudouridine methyltransferase

PDB Compounds: (A:) Ribosomal RNA small subunit methyltransferase NEP1

SCOPe Domain Sequences for d5faia_:

Sequence; same for both SEQRES and ATOM records:

>d5faia_ c.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkiggrrlivvlegasletvkvgktyellncdkhksillkngrdpgearpdithqsllml
mdsplnragllqvyihtqknvlievnpqtriprtfdrfcglmvqllhklsvraadgpqkl
lkviknpvsdhfpvgcmkvgtsfsipvvsdvrelvpssdpivfvvgafahgkvsveytek
mvsisnyplsaaltcaklttafeevwgvi

Timeline for d5faia_:

• d5faia_ first appeared in SCOPe 2.06
  
• d5faia_ appears in SCOPe 2.07