Lineage for d1hnzb_ (1hnz B:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241713Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 241714Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 241715Protein Ribosomal protein S2 [52315] (1 species)
  7. 241716Species Thermus thermophilus [TaxId:274] [52316] (14 PDB entries)
  8. 241721Domain d1hnzb_: 1hnz B: [31402]
    Other proteins in same PDB: d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzb_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOP Domain Coordinates for d1hnzb_:

Click to download the PDB-style file with coordinates for d1hnzb_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzb_: