Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) fold elaborated with additional structures |
Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
Protein Ribosomal protein S2 [52315] (1 species) |
Species Thermus thermophilus [TaxId:274] [52316] (14 PDB entries) |
Domain d1hnzb_: 1hnz B: [31402] Other proteins in same PDB: d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzo_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_ complexed with hyg, mg, zn |
PDB Entry: 1hnz (more details), 3.3 Å
SCOP Domain Sequences for d1hnzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnzb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus} vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
Timeline for d1hnzb_: