Lineage for d5f5rb_ (5f5r B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974077Species Human (Homo sapiens) [TaxId:9606] [225008] (15 PDB entries)
  8. 2974092Domain d5f5rb_: 5f5r B: [314019]
    automated match to d3omub_
    complexed with anp, mg

Details for d5f5rb_

PDB Entry: 5f5r (more details), 1.85 Å

PDB Description: trap1n-adpnp
PDB Compounds: (B:) Heat shock protein 75 kDa, mitochondrial

SCOPe Domain Sequences for d5f5rb_:

Sequence, based on SEQRES records: (download)

>d5f5rb_ d.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhsiisstesvqgstskhefqaetkklldivarslysekevfirelisnasdaleklrh
klvsdgqalpemeihlqtnaekgtitiqdtgigmtqeelvsnlgtiarsgskafldalqn
qaeasskiigqfgvgfysafmvadrvevysrsaapgslgyqwlsdgsgvfeiaeasgvrt
gtkiiihlksdckefssearvrdvvtkysnfvsfplylngrrmnt

Sequence, based on observed residues (ATOM records): (download)

>d5f5rb_ d.122.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhsiisstesvqgstskhefqaetkklldivarslysekevfirelisnasdaleklrh
klvsalpemeihlqtnaekgtitiqdtgigmtqeelvsnlgtiarsgskafldalqnqae
asskiigqfgvgfysafmvadrvevysrsaapgslgyqwlsdgsgvfeiaeasgvrtgtk
iiihlksdckefssearvrdvvtkysnfvsfplylngrrmnt

SCOPe Domain Coordinates for d5f5rb_:

Click to download the PDB-style file with coordinates for d5f5rb_.
(The format of our PDB-style files is described here.)

Timeline for d5f5rb_: