Lineage for d5f97e1 (5f97 E:7-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743993Domain d5f97e1: 5f97 E:7-114 [314008]
    Other proteins in same PDB: d5f97e2, d5f97e3, d5f97f2, d5f97f3, d5f97g2, d5f97g3, d5f97h2, d5f97h3
    automated match to d4ldeb_

Details for d5f97e1

PDB Entry: 5f97 (more details), 2.62 Å

PDB Description: blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group a type 1 hexasaccharide
PDB Compounds: (E:) Nanbody Nb-ER19

SCOPe Domain Sequences for d5f97e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f97e1 b.1.1.1 (E:7-114) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscaasgsifsgnvmgwyrqapgklrewvaaitpqgvpnyadsvkg
rftisrdnaknmlylqmsslkpedtalyycnrlpnyrswgqgtqvtvs

SCOPe Domain Coordinates for d5f97e1:

Click to download the PDB-style file with coordinates for d5f97e1.
(The format of our PDB-style files is described here.)

Timeline for d5f97e1: