Lineage for d5aewd_ (5aew D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936665Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2936697Domain d5aewd_: 5aew D: [314002]
    Other proteins in same PDB: d5aewa1, d5aewa2, d5aewc1, d5aewc2, d5aewe1, d5aewe2, d5aewg1, d5aewg2, d5aewi1, d5aewi2, d5aewk1, d5aewk2, d5aewm1, d5aewm2, d5aewo1, d5aewo2, d5aewq1, d5aewq2, d5aews1, d5aews2, d5aewu1, d5aewu2, d5aeww1, d5aeww2
    automated match to d2xsob_
    complexed with bnl, fe2, fes

Details for d5aewd_

PDB Entry: 5aew (more details), 1.88 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
PDB Compounds: (D:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d5aewd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aewd_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
mff

SCOPe Domain Coordinates for d5aewd_:

Click to download the PDB-style file with coordinates for d5aewd_.
(The format of our PDB-style files is described here.)

Timeline for d5aewd_: