Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (28 species) not a true protein |
Species Leishmania donovani [TaxId:5661] [313997] (1 PDB entry) |
Domain d5f7ia2: 5f7i A:127-256 [314001] Other proteins in same PDB: d5f7ia3, d5f7ib3, d5f7ic3, d5f7id3, d5f7ie3, d5f7if3 automated match to d4cs5a2 protein/DNA complex; complexed with tlv |
PDB Entry: 5f7i (more details), 2.95 Å
SCOPe Domain Sequences for d5f7ia2:
Sequence, based on SEQRES records: (download)
>d5f7ia2 d.131.1.0 (A:127-256) automated matches {Leishmania donovani [TaxId: 5661]} gipemdyrstvtlnsaefakivrdmqvfgdtvtiaiskegvkfsssgdvgqgytflqaag vsdrstkgvevtmeepitlsfalrfmgifakgstlservtlkfakdspcmveygidnvgy lryylapkvd
>d5f7ia2 d.131.1.0 (A:127-256) automated matches {Leishmania donovani [TaxId: 5661]} gipemdyrstvtlnsaefakivrdmqvfgdtvtiaiskegvkfsssgdvgqgytflqaag vsdrgvevtmeepitlsfalrfmgifakgstlservtlkfakdspcmveygidnvgylry ylapkvd
Timeline for d5f7ia2: