| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) ![]() |
| Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
| Protein automated matches [226907] (20 species) not a true protein |
| Domain d5f7ia1: 5f7i A:1-126 [314000] Other proteins in same PDB: d5f7ia3, d5f7ib3, d5f7ic3, d5f7id3, d5f7ie3, d5f7if3 automated match to d4cs5a1 protein/DNA complex; complexed with tlv |
PDB Entry: 5f7i (more details), 2.95 Å
SCOPe Domain Sequences for d5f7ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f7ia1 d.131.1.0 (A:1-126) automated matches {Leishmania donovani [TaxId: 5661]}
mleaqvqfaslwkrlvecinglvneanfdcnpgglsvqamdsshvalvhmllrddcfvky
qcgrnsilglnlaslskvlkivdsndslslrhdddsdvvtltsenpektrkceyqlklle
ieaesm
Timeline for d5f7ia1: