Lineage for d1f8xb_ (1f8x B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22268Superfamily c.23.14: Nucleoside 2-deoxyribosyltransferase [52309] (1 family) (S)
  5. 22269Family c.23.14.1: Nucleoside 2-deoxyribosyltransferase [52310] (1 protein)
  6. 22270Protein Nucleoside 2-deoxyribosyltransferase [52311] (1 species)
  7. 22271Species Lactobacillus leichmannii [TaxId:28039] [52312] (2 PDB entries)
  8. 22275Domain d1f8xb_: 1f8x B: [31398]

Details for d1f8xb_

PDB Entry: 1f8x (more details), 2.5 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase

SCOP Domain Sequences for d1f8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8xb_ c.23.14.1 (B:) Nucleoside 2-deoxyribosyltransferase {Lactobacillus leichmannii}
pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy

SCOP Domain Coordinates for d1f8xb_:

Click to download the PDB-style file with coordinates for d1f8xb_.
(The format of our PDB-style files is described here.)

Timeline for d1f8xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f8xa_