Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.3: Quinone reductase [52235] (4 proteins) binds FAD |
Protein automated matches [190235] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187003] (8 PDB entries) |
Domain d5ea2a_: 5ea2 A: [313969] Other proteins in same PDB: d5ea2c2 automated match to d1d4aa_ complexed with fad |
PDB Entry: 5ea2 (more details), 2.01 Å
SCOPe Domain Sequences for d5ea2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ea2a_ c.23.5.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mvgrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgkl kdpanfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwferv figefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfc gfqvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmk kevqdeeknkkfglsvghhlgksiptdnqikar
Timeline for d5ea2a_:
View in 3D Domains from other chains: (mouse over for more information) d5ea2c1, d5ea2c2, d5ea2e_, d5ea2g_ |