SCOPe 2.08: Domain d4y5ze_: 4y5z E:

Lineage for d4y5ze_ (4y5z E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)

6. Protein automated matches [190821] (1 species)
   not a true protein

7. Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries)

8. Domain d4y5ze_: 4y5z E: [313957]
   automated match to d1x36a_
   complexed with so4

Details for d4y5ze_

PDB Entry: 4y5z, 2.95 Å

PDB Description: t=1 capsid structure of semv ndel65cp fused with b-domain of s. aureus protein spa at the n-terminus (p1 crystal form)

PDB Compounds: (E:) Immunoglobulin G-binding protein A,Coat protein

SCOPe Domain Sequences for d4y5ze_:

Sequence; same for both SEQRES and ATOM records:

>d4y5ze_ b.121.4.7 (E:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmiepta

Timeline for d4y5ze_:

• d4y5ze_ first appeared in SCOPe 2.06
  
• d4y5ze_ appears in SCOPe 2.07