Lineage for d1f8ya_ (1f8y A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117411Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2117412Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 2117413Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 2117414Species Lactobacillus leichmannii [TaxId:28039] [52312] (2 PDB entries)
  8. 2117415Domain d1f8ya_: 1f8y A: [31395]
    complexed with 5-methyl-2'-deoxypseudouridine
    complexed with 5md

Details for d1f8ya_

PDB Entry: 1f8y (more details), 2.4 Å

PDB Description: crystal structure analysis of nucleoside 2-deoxyribosyltransferase complexed with 5-methyl-2'-deoxypseudouridine
PDB Compounds: (A:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d1f8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8ya_ c.23.14.1 (A:) Nucleoside 2-deoxyribosyltransferase {Lactobacillus leichmannii [TaxId: 28039]}
pkktiyfgagwftdrqnkaykeamealkenptidlensyvpldnqykgirvdehpeylhd
kvwatatynndlngiktndimlgvyipdeedvglgmelgyalsqgkyvllvipdedygkp
inlmswgvsdnvikmsqlkdfnfnkprfdfyegavy

SCOPe Domain Coordinates for d1f8ya_:

Click to download the PDB-style file with coordinates for d1f8ya_.
(The format of our PDB-style files is described here.)

Timeline for d1f8ya_: