Lineage for d5eqca_ (5eqc A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2473177Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries)
  8. 2473190Domain d5eqca_: 5eqc A: [313942]
    automated match to d4nogb_
    complexed with bgc, bme, btb, glc, peg, plp, trs

Details for d5eqca_

PDB Entry: 5eqc (more details), 2.2 Å

PDB Description: structure of the ornithine aminotransferase from toxoplasma gondii crystallized in presence of oxidized glutathione reveals partial occupancy of plp at the protein active site
PDB Compounds: (A:) Ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d5eqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eqca_ c.67.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
garktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydf
lagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmnt
gaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpft
pgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlli
vdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgs
tfggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrglln
avevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflav
eeerkk

SCOPe Domain Coordinates for d5eqca_:

Click to download the PDB-style file with coordinates for d5eqca_.
(The format of our PDB-style files is described here.)

Timeline for d5eqca_: