SCOP 1.55: Domain d1d0il_: 1d0i L:

Lineage for d1d0il_ (1d0i L:)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family)

5. Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)

6. Protein Type II 3-dehydroquinate dehydratase [52306] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [52308] (1 PDB entry)

8. Domain d1d0il_: 1d0i L: [31394]

Details for d1d0il_

PDB Entry: 1d0i, 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions

SCOP Domain Sequences for d1d0il_:

Sequence; same for both SEQRES and ATOM records:

>d1d0il_ c.23.13.1 (L:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalaga

Timeline for d1d0il_:

• d1d0il_ appears in SCOP 1.57
  
• d1d0il_ appears in the current release, SCOPe 2.08