Lineage for d4y9ua2 (4y9u A:240-518)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063096Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2063097Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2063118Protein automated matches [227066] (3 species)
    not a true protein
  7. 2063134Species Norway rat (Rattus norvegicus) [TaxId:10116] [256000] (10 PDB entries)
  8. 2063140Domain d4y9ua2: 4y9u A:240-518 [313929]
    Other proteins in same PDB: d4y9ua1, d4y9ua3, d4y9ub1, d4y9ub3
    automated match to d1j9za1
    complexed with fad, fmn, nap, po4; mutant

Details for d4y9ua2

PDB Entry: 4y9u (more details), 1.95 Å

PDB Description: rat cypor mutant - g143del
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y9ua2:

Sequence, based on SEQRES records: (download)

>d4y9ua2 b.43.4.1 (A:240-518) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh
pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw
vvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveye
aksgrvnkgvatswlrakepagenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d4y9ua2 b.43.4.1 (A:240-518) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssirqyelvvhedmdvakvytgemgrlksyenqkppfdaknpflaavtanrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqigeilgadldvimslnnldeesnkkh
pfpcpttyrtaltyylditnpprtnvlyelaqyasepseqehlhkmasssgegkelylsw
vvearrhilailqdypslrppidhlcellprlqaryysiassskvhpnsvhicavaveye
aksgrvnkgvatswlrakepagralvpmfvrksqf

SCOPe Domain Coordinates for d4y9ua2:

Click to download the PDB-style file with coordinates for d4y9ua2.
(The format of our PDB-style files is described here.)

Timeline for d4y9ua2: