Lineage for d4y9ua1 (4y9u A:62-239)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857049Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)
  8. 2857056Domain d4y9ua1: 4y9u A:62-239 [313928]
    Other proteins in same PDB: d4y9ua2, d4y9ua3, d4y9ub2, d4y9ub3
    automated match to d1ja1a2
    complexed with fad, fmn, nap, po4; mutant

Details for d4y9ua1

PDB Entry: 4y9u (more details), 1.95 Å

PDB Description: rat cypor mutant - g143del
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4y9ua1:

Sequence, based on SEQRES records: (download)

>d4y9ua1 c.23.5.0 (A:62-239) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
lsslpeidkslvvfcmatygedptdnaqdfydwlqetdvdltgvkfavfglgnktyehfn
amgkyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatgee

Sequence, based on observed residues (ATOM records): (download)

>d4y9ua1 c.23.5.0 (A:62-239) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ppvkessfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydlad
lsslpeidkslvvfcmatyptdnaqdfydwlqetdvdltgvkfavfglgnktyehfnamg
kyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavceffgveatee

SCOPe Domain Coordinates for d4y9ua1:

Click to download the PDB-style file with coordinates for d4y9ua1.
(The format of our PDB-style files is described here.)

Timeline for d4y9ua1: