SCOPe 2.08: Domain d4y99a_: 4y99 A:

Lineage for d4y99a_ (4y99 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)

8. Domain d4y99a_: 4y99 A: [313927]
   Other proteins in same PDB: d4y99b_
   automated match to d1j1da_
   complexed with ca, dms

Details for d4y99a_

PDB Entry: 4y99, 2 Å

PDB Description: core domain of human cardiac troponin

PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d4y99a_:

Sequence, based on SEQRES records:

>d4y99a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkiml
qatgetiteddieelmkdgdknndgridydeflefmkgve

Sequence, based on observed residues (ATOM records):

>d4y99a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmgkseeelsdlfrmfdknadgyidleelkimlqatge
titeddieelmkdgdknndgridydeflefmkgve

Timeline for d4y99a_:

• d4y99a_ first appeared in SCOPe 2.06
  
• d4y99a_ appears in SCOPe 2.07