Lineage for d4y99a_ (4y99 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711123Protein Troponin C [47503] (6 species)
  7. 2711158Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. 2711167Domain d4y99a_: 4y99 A: [313927]
    Other proteins in same PDB: d4y99b_
    automated match to d1j1da_
    complexed with ca, dms

Details for d4y99a_

PDB Entry: 4y99 (more details), 2 Å

PDB Description: core domain of human cardiac troponin
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d4y99a_:

Sequence, based on SEQRES records: (download)

>d4y99a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkiml
qatgetiteddieelmkdgdknndgridydeflefmkgve

Sequence, based on observed residues (ATOM records): (download)

>d4y99a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmgkseeelsdlfrmfdknadgyidleelkimlqatge
titeddieelmkdgdknndgridydeflefmkgve

SCOPe Domain Coordinates for d4y99a_:

Click to download the PDB-style file with coordinates for d4y99a_.
(The format of our PDB-style files is described here.)

Timeline for d4y99a_: