![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Ethr repressor [109978] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
![]() | Domain d5f0ca2: 5f0c A:95-214 [313914] Other proteins in same PDB: d5f0ca1 automated match to d3q0wa2 complexed with 5te, so4 |
PDB Entry: 5f0c (more details), 1.87 Å
SCOPe Domain Sequences for d5f0ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f0ca2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]} adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5f0ca2: