Lineage for d1d0ii_ (1d0i I:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22250Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (1 family) (S)
  5. 22251Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (1 protein)
  6. 22252Protein Type II 3-dehydroquinate dehydratase [52306] (2 species)
  7. 22255Species Streptomyces coelicolor [TaxId:1902] [52308] (1 PDB entry)
  8. 22264Domain d1d0ii_: 1d0i I: [31391]

Details for d1d0ii_

PDB Entry: 1d0i (more details), 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions

SCOP Domain Sequences for d1d0ii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ii_ c.23.13.1 (I:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalag

SCOP Domain Coordinates for d1d0ii_:

Click to download the PDB-style file with coordinates for d1d0ii_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ii_: