![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins) |
![]() | Protein automated matches [190821] (1 species) not a true protein |
![]() | Species SMV (Sesbania mosaic virus) [TaxId:12558] [188106] (4 PDB entries) |
![]() | Domain d4y4yd_: 4y4y D: [313893] automated match to d1x36a_ complexed with so4 |
PDB Entry: 4y4y (more details), 3 Å
SCOPe Domain Sequences for d4y4yd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y4yd_ b.121.4.7 (D:) automated matches {SMV (Sesbania mosaic virus) [TaxId: 12558]} gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc tytiqmiepta
Timeline for d4y4yd_: