Lineage for d5f7hf_ (5f7h F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758244Domain d5f7hf_: 5f7h F: [313892]
    Other proteins in same PDB: d5f7ha2, d5f7hb2, d5f7hd2, d5f7he2
    automated match to d5dzna_
    complexed with ca, sep

Details for d5f7hf_

PDB Entry: 5f7h (more details), 2.5 Å

PDB Description: human t-cell immunoglobulin and mucin domain protein 4 (htim-4) complex with phosphoserine
PDB Compounds: (F:) T-cell immunoglobulin and mucin domain-containing protein 4

SCOPe Domain Sequences for d5f7hf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f7hf_ b.1.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
setvvtevlghrvtlpclysswshnsnsmcwgkdqcpysgckealirtdgmrvtsrksak
yrlqgtiprgdvsltilnpsesdsgvyccrievpgwfndvkinvrlnlqra

SCOPe Domain Coordinates for d5f7hf_:

Click to download the PDB-style file with coordinates for d5f7hf_.
(The format of our PDB-style files is described here.)

Timeline for d5f7hf_: