Lineage for d5f27a1 (5f27 A:24-93)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982573Species Mycobacterium tuberculosis [TaxId:83331] [313822] (9 PDB entries)
  8. 1982575Domain d5f27a1: 5f27 A:24-93 [313887]
    Other proteins in same PDB: d5f27a2
    automated match to d1t56a1
    complexed with 5tt

Details for d5f27a1

PDB Entry: 5f27 (more details), 1.68 Å

PDB Description: structure of transcriptional regulatory repressor protein - ethr from mycobacterium tuberculosis in complex with compound 2 at 1.68a resolution
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d5f27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f27a1 a.4.1.0 (A:24-93) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

SCOPe Domain Coordinates for d5f27a1:

Click to download the PDB-style file with coordinates for d5f27a1.
(The format of our PDB-style files is described here.)

Timeline for d5f27a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f27a2