Lineage for d5ezph_ (5ezp H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2768958Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
    automatically mapped to Pfam PF00576
  6. 2769696Protein automated matches [190376] (1 species)
    not a true protein
  7. 2769697Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries)
  8. 2769730Domain d5ezph_: 5ezp H: [313875]
    automated match to d1ttaa_
    complexed with edo, ipj

Details for d5ezph_

PDB Entry: 5ezp (more details), 2.5 Å

PDB Description: human transthyretin (ttr) complexed with 4-hydroxy-chalcone
PDB Compounds: (H:) Transthyretin

SCOPe Domain Sequences for d5ezph_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ezph_ b.3.4.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d5ezph_:

Click to download the PDB-style file with coordinates for d5ezph_.
(The format of our PDB-style files is described here.)

Timeline for d5ezph_: