Lineage for d1d0ie_ (1d0i E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1839588Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 1839589Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 1839590Protein Type II 3-dehydroquinate dehydratase [52306] (6 species)
  7. 1839654Species Streptomyces coelicolor [TaxId:1902] [52308] (4 PDB entries)
  8. 1839683Domain d1d0ie_: 1d0i E: [31387]
    complexed with po4, trs

Details for d1d0ie_

PDB Entry: 1d0i (more details), 1.8 Å

PDB Description: crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with phosphate ions
PDB Compounds: (E:) type II 3-dehydroquinate hydratase

SCOPe Domain Sequences for d1d0ie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ie_ c.23.13.1 (E:) Type II 3-dehydroquinate dehydratase {Streptomyces coelicolor [TaxId: 1902]}
prslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnheg
elvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhs
yvsqradgvvagcgvqgyvfgveriaalagag

SCOPe Domain Coordinates for d1d0ie_:

Click to download the PDB-style file with coordinates for d1d0ie_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ie_: