SCOPe 2.08: Domain d5ezvf1: 5ezv F:25-182

Lineage for d5ezvf1 (5ezv F:25-182)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d5ezvf1: 5ezv F:25-182 [313852]
   automated match to d2v8qe2
   complexed with c1v, c2z, stu

Details for d5ezvf1

PDB Entry: 5ezv, 2.99 Å

PDB Description: x-ray crystal structure of amp-activated protein kinase alpha-2/alpha- 1 rim chimaera (alpha-2(1-347)/alpha-1(349-401)/alpha-2(397-end) beta-1 gamma-1) co-crystallized with c2 (5-(5-hydroxyl-isoxazol-3- yl)-furan-2-phosphonic acid)

PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d5ezvf1:

Sequence; same for both SEQRES and ATOM records:

>d5ezvf1 d.37.1.1 (F:25-182) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nnsvytsfmkshrcydliptssklvvfdtslqvkkaffalvtngvraaplwdskkqsfvg
mltitdfinilhryyksalvqiyeleehkietwrevylqdsfkplvcispnaslfdavss
lirnkihrlpvidpesgntlyilthkrilkflklfite

Timeline for d5ezvf1:

• d5ezvf1 first appeared in SCOPe 2.06
  
• d5ezvf1 appears in SCOPe 2.07