| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
| Protein Ethr repressor [109978] (2 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries) Uniprot P96222 22-215 |
| Domain d5f0ha2: 5f0h A:95-214 [313848] Other proteins in same PDB: d5f0ha1 automated match to d3q0wa2 complexed with 5tc |
PDB Entry: 5f0h (more details), 1.99 Å
SCOPe Domain Sequences for d5f0ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f0ha2 a.121.1.1 (A:95-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
Timeline for d5f0ha2: