SCOPe 2.06: Domain d5f37a_: 5f37 A:

Lineage for d5f37a_ (5f37 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801

6. Protein JMJD2A core [254342] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254775] (41 PDB entries)

8. Domain d5f37a_: 5f37 A: [313842]
   automated match to d4v2wb_
   complexed with dms, edo, n5j, zn

Details for d5f37a_

PDB Entry: 5f37, 2.22 Å

PDB Description: crystal structure of human kdm4a in complex with compound 58

PDB Compounds: (A:) lysine-specific demethylase 4a

SCOPe Domain Sequences for d5f37a_:

Sequence; same for both SEQRES and ATOM records:

>d5f37a_ b.82.2.14 (A:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
setlnpsarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddidd
lvipapiqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywkn
ltfnppiygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwkts
fawhtedmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtl
isplmlkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqav
lcscrkdmvkismdvfvrkfqperyklwkagkdntvidhtlptpeaaefl

Timeline for d5f37a_:

• d5f37a_ is new in SCOPe 2.06-stable
  
• d5f37a_ appears in SCOPe 2.07
  
• d5f37a_ appears in the current release, SCOPe 2.08